PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN32052.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 310aa    MW: 35709.1 Da    PI: 7.2032
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN32052.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.2e-162471148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+ eEd+ll+ +++  G g+W++ a + g++Rt+k+c++rw++yl
       KHN32052.1 24 RGPWSVEEDDLLISYIANNGEGRWNLLAIRSGLRRTGKSCRLRWLNYL 71
                     89********************************************97 PP

2Myb_DNA-binding48.91.5e-1577120146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+ +++ ++G++ W++Ia+ ++ gRt++++k++w++
       KHN32052.1  77 RGNLTSEEQLLIFELHSKWGNR-WSKIAHQLP-GRTDNEIKNYWRT 120
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.3271971IPR017930Myb domain
SuperFamilySSF466891.39E-2821118IPR009057Homeodomain-like
SMARTSM007179.8E-142373IPR001005SANT/Myb domain
PfamPF002494.2E-152471IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-212578IPR009057Homeodomain-like
CDDcd001673.62E-102671No hitNo description
PROSITE profilePS5129424.21272126IPR017930Myb domain
SMARTSM007175.9E-1476124IPR001005SANT/Myb domain
PfamPF002496.5E-1477120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-2279125IPR009057Homeodomain-like
CDDcd001672.81E-1181120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MRLAMSTPSK SIICSREDDY ELRRGPWSVE EDDLLISYIA NNGEGRWNLL AIRSGLRRTG  60
KSCRLRWLNY LKPNVKRGNL TSEEQLLIFE LHSKWGNRWS KIAHQLPGRT DNEIKNYWRT  120
RIQKRAKYLK FEAHRKSRFV EFVKGLQMTR YLHKAQESSP SAMSIQDQAI PLPFDGVTIP  180
HYSSFGIGTT PTTQITCQGG LNHLNQQDQN SESEHNNGSC ISSSESANIP YMSQPLGHTT  240
SQFQALDNCD FGICSYDGYS IDNNSYDMDA LNLTTTMVAE NLELPVFDVQ ISEPYFMNMD  300
ELWQFRNIQR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25211264108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2356960.0AC235696.2 Glycine max clone GM_WBb0070F18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003534166.30.0PREDICTED: transcription repressor MYB6-like
TrEMBLA0A0B2RJN70.0A0A0B2RJN7_GLYSO; Myb-related protein 305
TrEMBLI1L4B80.0I1L4B8_SOYBN; Uncharacterized protein
STRINGGLYMA09G31570.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16393494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25340.12e-63myb domain protein 116
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]